PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN10414.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 302aa    MW: 33058.9 Da    PI: 8.4903
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN10414.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.57.5e-09855447
                     S-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrwqky 47
                     W+ eE++ + +a++++  +     +W++Ia+ ++  ++ +++k ++q +
       KHN10414.1  8 WSYEEEKAFENAIAMHWIEesskeQWEKIASAVP-SKSMEDVKQHYQVL 55
                     *****************99***************.************86 PP

2Myb_DNA-binding40.75.4e-13136180347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
       KHN10414.1 136 PWTEEEHRLFLLGLEKFGKGDWRSISRNFVISRTPTQVASHAQKY 180
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.001360IPR017884SANT domain
SMARTSM007172.5E-5458IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-5755IPR009057Homeodomain-like
PfamPF002491.5E-6855IPR001005SANT/Myb domain
CDDcd001679.24E-8856No hitNo description
SuperFamilySSF466894.38E-9862IPR009057Homeodomain-like
PROSITE profilePS5129416.902129185IPR017930Myb domain
SuperFamilySSF466895.02E-17131186IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-17133183IPR006447Myb domain, plants
SMARTSM007173.2E-11133183IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-11134179IPR009057Homeodomain-like
PfamPF002492.0E-11136180IPR001005SANT/Myb domain
CDDcd001671.58E-10136181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MSSSGTIWSY EEEKAFENAI AMHWIEESSK EQWEKIASAV PSKSMEDVKQ HYQVLVEDVS  60
AIEAGHISFP NYAASEEITS SNKDFHGSSK ATSSDKRSNC NYGRGFSGLG HDSTTHSSGK  120
GGLSRSSEQE RRKGIPWTEE EHRLFLLGLE KFGKGDWRSI SRNFVISRTP TQVASHAQKY  180
FIRLNSMNRD RRRSSIHDIT SVNNGDVANN QAPITGQHSS TIPSNTMGVG QSLKHRVQGH  240
IPPGLGMYGT PVGHPVAAPP GHMASAVGTP VMLPPGPHPH AHPHPPYVLP LAYPMAPPTM  300
HQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-14472773RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312030.0KT031203.1 Glycine max clone HN_CCL_93 MYB/HD-like transcription factor (Glyma17g13010.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014507110.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H73e-62DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B2PRU80.0A0A0B2PRU8_GLYSO; Transcription factor MYB1R1
TrEMBLI1MUF90.0I1MUF9_SOYBN; MYB/HD-like transcription factor
STRINGGLYMA17G13010.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106943340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.17e-82MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]